PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco014614.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MYB
Protein Properties Length: 281aa    MW: 32020.7 Da    PI: 8.224
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco014614.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.61.4e-181865148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd+ll + v+q+G g+W+++++  g++R++k+c++rw +yl
      Aco014614.1 18 KGPWTSEEDKLLMQHVNQHGEGRWNSVSKLTGLRRSGKSCRLRWVNYL 65
                     79********************************************97 PP

2Myb_DNA-binding52.61e-1671115147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T++E+ +++++++++G++ W+tIar ++ gRt++++k++w+++
      Aco014614.1  71 KGKITPQEENIILELHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 115
                      6899******************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3911365IPR017930Myb domain
SuperFamilySSF466893.36E-3016112IPR009057Homeodomain-like
SMARTSM007172.8E-151767IPR001005SANT/Myb domain
PfamPF002492.1E-171865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-241972IPR009057Homeodomain-like
CDDcd001677.28E-112065No hitNo description
PROSITE profilePS5129425.60666120IPR017930Myb domain
SMARTSM007174.7E-1670118IPR001005SANT/Myb domain
PfamPF002498.5E-1571115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2473119IPR009057Homeodomain-like
CDDcd001672.93E-1075115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MESHFGWESA LHEDGWRKGP WTSEEDKLLM QHVNQHGEGR WNSVSKLTGL RRSGKSCRLR  60
WVNYLRPDLK KGKITPQEEN IILELHALWG NRWSTIARSL PGRTDNEIKN YWRTHYKKSK  120
PSKSVERARA QFLKHQQLER KKQQLQQQQQ LQLQQLQQLQ QQEQVLLMHP YDMQQRLTAG  180
AEKEAEALAV AAQQQMQEMD QFLLYPGSYD LLQGSSSGGG GGGTTSEDGS TTEDGGGGWG  240
SLWNLDDVYG DVGVGRVGCR GNLVMRAEEF AFYYNNNNNN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-261811227120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010918950.11e-94PREDICTED: myb-related protein 340
TrEMBLW5ASU92e-89W5ASU9_WHEAT; Uncharacterized protein
STRINGGSMUA_Achr1P03450_0017e-87(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.12e-64myb domain protein 305